PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010095978.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 504aa    MW: 55346.9 Da    PI: 6.1126
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010095978.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-32265319155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr+rWtpeLHerF+eav++L G+ekAtPk +l+lmkv+gLt++hvkSHLQkYRl
  XP_010095978.1 265 KPRMRWTPELHERFIEAVRKLYGAEKATPKGVLKLMKVEGLTIYHVKSHLQKYRL 319
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.237262322IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-30263320IPR009057Homeodomain-like
SuperFamilySSF466895.38E-17264319IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-24265320IPR006447Myb domain, plants
PfamPF002497.6E-9267318IPR001005SANT/Myb domain
PfamPF143794.2E-23366413IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MMNRHSIVSV TQSEPSKGVP QPYCIPVHDF LSIGSEGKSL LVGECSSPHP SPFIRTESLG  60
SPFIGAASTH PPKFYYGSEL NSPASPGSHT HHAKNAFSRS SVFCTSLYQS SSSSSETHRQ  120
LGNLPFLPPP TCNQSSSAVD TKSPLIFSGD ITNNEYGNDE SEDLLKDFLN LPGDASQNRF  180
HSLTCASDSL ALTEQLELHY LSDDLDIAIT DHGETPGVDE IYETPQAPLK PSIELMCNQS  240
HRSAAPPPID SLSIHPSPGP AAAHKPRMRW TPELHERFIE AVRKLYGAEK ATPKGVLKLM  300
KVEGLTIYHV KSHLQKYRLA KYMPEKKEVD TYALSCLSPE KKPSSPEEKK TVSINNESDG  360
RRKGSVQITE ALRMQMEVQK QLHEQLEVQR ALQLRIEEHA KYLQKILEEQ QKAGSALASS  420
QALSSVTSPC SQDSERQPPP SVLKSPPQLA ESKSDSSLSS LPSKSKAGES GRDCEPEESN  480
KRLRLDEEEK CAGDETVVEN ADQQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095978.10.0Myb family transcription factor APL
TrEMBLW9R8N60.0W9R8N6_9R
STRINGPOPTR_0007s15110.11e-178(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF134691925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-111G2-like family protein